Everything below concerns counterion. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-04-09. Where a claim depends on a specific study, the study is described rather than over-claimed.
The molecule is a short, linear, hydrophilic peptide that dissolves readily in water or aqueous buffer. Its principal chemical liabilities are hydrolytic rather than oxidative, since it contains no cysteine, methionine, or tryptophan residues. The aspartate–glycine step is a recognised site for aspartimide formation under mildly acidic or basic conditions, generating isoaspartate and succinimide-related products over time. Desiccated lyophilised powder held at −20 °C is comparatively stable, whereas dilute solutions degrade faster and are best frozen as single-use aliquots rather than thawed repeatedly.
No pharmacopoeial monograph exists for this peptide, so quality rests on the supplier's internal specifications and on whatever independent testing a purchaser arranges. Certificates of analysis differ widely in which tests they report and in the limits applied. The counter-ion introduced during purification, commonly acetate or trifluoroacetate, changes the net peptide content of a given mass of powder, so two samples of equal weight may not contain equal amounts of the active sequence. Third-party laboratories can verify purity, identity, residual solvents, and counter-ion content for a fee, which makes documentation more informative than labelling.
The most frequently cited laboratory finding is that AEDG increased telomerase activity and extended telomere length in cultured human somatic cells. That work used fetal fibroblast strains and reported changes in enzyme activity alongside altered division counts. Replication by unrelated groups has been limited, and the published record is largely a single-laboratory series rather than a multi-centre programme. The result supports a hypothesis about peptide influence on gene expression in cell culture; it does not by itself establish an effect on telomere length in living animals or in people.
Animal and clinical reports appear mainly in Russian-language journals from the 1990s and 2000s, covering endpoints such as melatonin rhythm, lifespan in aged rodents, and retinal function. Many of these papers involve small groups, lack blinding or placebo comparison, and are difficult to retrieve through indexed databases. Review articles published in English generally summarise the claims without reanalysing the underlying data. Because no large randomised trial exists, the clinical importance of these reported effects stays unresolved and is properly described as an open question.
| Property | Value | Notes |
|---|---|---|
| Identity confirmation | Electrospray or MALDI mass spectrometry | Observed mass compared with theoretical 390.35 Da |
| Purity specification | 95 percent or greater by RP-HPLC | Common convention for research-grade peptide |
| Counter-ion | Acetate or trifluoroacetate | Affects net peptide content of a weighed sample |
| Solution storage | −80 °C as single-use aliquots | Repeated freeze–thaw cycles accelerate loss |
| Main degradation route | Aspartimide formation at Asp-Gly | Produces isoaspartate and related species |
Stability depends strongly on pH, temperature and the presence of oxygen and trace metals. Cleavage of the backbone proceeds faster under neutral to alkaline conditions, whereas acidic solutions tend to slow that reaction. The aspartate and glutamate side chains can undergo deamidation or imide formation over time, generating closely related impurities. Published stability data specific to epitalon are sparse, so the usable life of a given solution is best regarded as an open question that depends on buffer composition, concentration and storage temperature.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection, frequently near 214 nanometers where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the observed molecular mass and helps separate the intact peptide from truncated or modified forms. Amino acid analysis or tandem mass spectrometry can establish residue order. Purity is commonly quoted as an area percentage, yet such values are method-dependent, and comparisons between laboratories require matching column, gradient and detection wavelength.
Laboratory handling begins with dissolution of the lyophilized powder in water or a suitable aqueous buffer. The dry solid is the more stable form, so stock solutions are generally prepared only when required and kept cold afterwards. Repeated freezing and thawing of a solution is avoided because it encourages aggregation and gradual loss of the intact chain. Diluents and containers are selected to limit adsorption of a short peptide onto plastic surfaces and to reduce microbial growth in aqueous preparations.
Identity and purity are established with reversed-phase high-performance liquid chromatography and mass spectrometry. The chromatogram shows the main peak and any truncated or oxidised by-products, while the mass spectrum confirms the expected 390 dalton mass. Amino acid analysis can corroborate composition when a sample's origin is uncertain. Counterion content, particularly residual trifluoroacetate from purification, is frequently reported alongside purity because it shifts the net mass of the solid.
Reference material is normally supplied as a lyophilised powder in a sealed vial. Product literature typically recommends storage at minus twenty degrees Celsius or colder, protected from light and moisture. Freeze-thaw cycling is usually avoided because repeated condensation can introduce water into the vial. Working solutions are commonly prepared fresh, aliquoted, and kept cold for short periods rather than stored at ambient temperature. Labelling the date of opening helps track how long a vial has been in use.
Solubility is high in water, phosphate-buffered saline and normal saline, a pattern that follows from the two acidic residues in the chain. The peptide dissolves poorly in non-polar solvents such as hexane or chloroform. Stock solutions are often prepared in water first and then diluted into the buffer of interest. Because the molecule is small and hydrophilic, filtration through a low-protein-binding membrane is usually straightforward, and visible particulates are uncommon in freshly made solutions.
=== November === November 1 The U.S. Supreme Court begins its arguments about the Texas Heartbeat Act. Kenosha unrest shooting: The trial of Kyle Rittenhouse begins in Kenosha. November 2 New Jersey and Virginia gubernatorial elections are held. Republican Glenn Youngkin wins the Virginia race, while Democrat Phil Murphy wins re-election in the New Jersey race. Republican Winsome Sears wins the Virginia lieutenant governor's race and will become the first black and first female lieutenant governor of the state of Virginia. A special election is held in Ohio to fill a vacancy in its 11th congressional district left by Marcia Fudge when she resigned to become President Biden's Secretary of Housing and Urban Development. Democrat Shontel Brown wins with 81,636 of the 103,565 votes cast (78.8%). Another special election is held in Ohio to fill a vacancy in its 15th congressional district due to the resignation of Steve Stivers effective May 15 to become president and CEO of the Ohio Chamber of Commerce. Republican Mike Carey wins with 93,255 of the 160,012 votes cast (58.3%). The Atlanta Braves win the 2021 World Series, defeating the Houston Astros. Las Vegas Raiders wide receiver Henry Ruggs III is involved in an automobile accident where a 23-year-old woman is killed. At the time of the crash, Ruggs was driving 120 mph (190 km/h). He was also over double the legal intoxication level as well. The Raiders immediately cut him later that day.
Reversed-phase HPLC (RP-HPLC) is the most widespread mode of chromatography. It has a non-polar stationary phase and an aqueous, moderately polar mobile phase. RP-HPLC is so commonly used among the biologists and life science users, that it is often referred to as simply "HPLC". The pharmaceutical industry also regularly employs RP-HPLC to qualify drugs before their release. In the reversed phase methods, the substances are retained in the system the more hydrophobic they are. For the retention of organic materials, the stationary phases, are consisted mainly of porous granules of silica gel packed in the column. In shape, they are usually spheres of varying diameters (sub-2, 3, 5, 7, 10 μm), varying pore diameters (60, 100, 150, 300 Å). On their surface are chemically bonded straight chain alkyl ligands, such as C3, C4, C8, C18. The number counts the carbon atoms in a ligand. For example, a C3 ligand is a propyl. The longer the hydrocarbon ligand on the stationary phase, the longer the sample components can be retained. Most of the current methods of separation of biomedical materials use C18 stationary phase, sometimes called by a trade names such as ODS (octadecylsilane) or RP-18 (Reversed Phase 18). To make such stationary phases, one treat the surface of silica gel particles with RMe2SiCl, where R is a straight chain alkyl group such as C18H37 or C8H17. To separate aromatic compounds, or in general compounds with many pi bonds, the stationary phase can have phenyl surface ligands. At pH < 2, the bond between the ligand and the silica gel may dissolve.
Many bacteria are motile (able to move themselves) and do so using a variety of mechanisms. The best studied of these are flagella, long filaments that are turned by a motor at the base to generate propeller-like movement. The bacterial flagellum is made of about 20 proteins, with approximately another 30 proteins required for its regulation and assembly. The flagellum is a rotating structure driven by a reversible motor at the base that uses the electrochemical gradient across the membrane for power.
Sources: en.wikipedia.org
==== Predictive Low Glucose Suspend (PLGS) ==== A step forward from threshold suspend systems, predictive low glucose suspend (PLGS) systems use a mathematical model to extrapolate predicted future blood sugar levels based on recent past readings from a CGM. This allows the system to reduce or halt insulin delivery prior to a predicted hypoglycemic event.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
=== Experimental or banned methods === Photodynamic therapy for hair removal (experimental) X-ray hair removal is an efficient, and usually permanent, hair removal method, but also causes severe health problems, occasional disfigurement, and even death. It is illegal in the United States.
A salvage pathway is a pathway in which a biological product is produced from intermediates in the degradative pathway of its own or a similar substance. The term often refers to nucleotide salvage in particular, in which nucleotides (purine and pyrimidine) are synthesized from intermediates in their degradative pathway. Nucleotide salvage pathways are used to recover bases and nucleosides that are formed during degradation of RNA and DNA. This is important in some organs because some tissues cannot undergo de novo synthesis. The salvaged products can then be converted back into nucleotides. Salvage pathways are targets for drug development, one family being called antifolates. A number of other biologically-important substances, like methionine and nicotinate, have their own salvage pathways to recycle parts of the molecule.
Sources: en.wikipedia.org
Mass spectrometry provides the identity check, because the observed mass is compared with the theoretical mass of the AEDG sequence. Chromatography separates and quantifies impurities but does not by itself prove which peptide is present. The two techniques are normally used together.
Yes. Trifluoroacetate and acetate ions remain associated with the peptide after purification, so a weighed quantity of powder contains less peptide than the nominal mass suggests. Certificates that report net peptide content rather than raw weight are more directly comparable between suppliers.
Dilute aqueous solutions are less stable than the dry powder and are usually aliquoted and frozen to avoid repeated freeze–thaw cycles. Lyophilised material is best stored desiccated at −20 °C, protected from light. Working solutions are typically prepared fresh from a frozen aliquot.
Small studies with human participants have been reported, chiefly in Russian-language journals, but they are limited in size and design. No large randomised controlled trial with published results is available.